PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g048701m
Common NameCISIN_1g048701mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family GRAS
Protein Properties Length: 520aa    MW: 58149.9 Da    PI: 6.5179
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g048701mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS222.61.9e-682085142304
               GRAS   2 velLlecAeavssgdlelaqalLarlsel.aspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                        ++ Ll++A++++s++l+laq +Larl+++ +sp+g+p++R+a++f+eAL++ l++ +  ++       + + + ++++ a+k+fs +sPi+ 
  orange1.1g048701m 208 IQELLRAADCFDSNELRLAQIILARLNQRlRSPAGKPLERAAFFFKEALNSLLNGLTRPTC------LSLWPEIIQSVRAYKAFSGMSPIPM 293
                        689*************************99*************************333333......3333348999*************** PP

               GRAS  93 fshltaNqaIleavege..ervHiiDfdisqGlQWpaLlqaLasRpeg.........ppslRiTgvgspesgskeeleetgerLakfAeelg 173
                        f+h+t+ qa+le++eg+    +HiiDfdi+ G Q++++++++a+++++           slRiT+++s  +g  +e++ ++++L +fA+el+
  orange1.1g048701m 294 FTHFTTTQALLESLEGSpvPLIHIIDFDIGFGSQYASFMREIAEKAHQyhsgsklmnLTSLRITAIVS--EGYVNETRLIKDNLVHFAQELR 383
                        *****************9999************************94444456666588*********..669999**************** PP

               GRAS 174 vpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqe..adh.nsesFlerfleale 262
                        ++f+ ++l+ +++e+l++++ ++  gE++ V l+  ++r l++s++ +    ++++ ++++sP+vvv++++e  a++ + + F + f+++le
  orange1.1g048701m 384 IRFHVDFLLLRTFEMLSFKAVKFMDGEKTSVVLSPTIFRRLANSTNNAV---AFVNDLRRISPTVVVFTDNEawAECgSVPLFRRNFVNSLE 472
                        *****************************************77776666...9*******************77788444568888****** PP

               GRAS 263 yysalfdsleaklpreseerikvErellgreivnvvacegae 304
                        yy+++f+sl+a + ++ ++++k+E  ll+++i+ +v  +ga+
  orange1.1g048701m 473 YYTMVFESLDAAAMNARDWARKIETYLLRPKITAAVEVAGAR 514
                        ***********999999*******************999875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098533.781181520IPR005202Transcription factor GRAS
PfamPF035146.7E-66208514IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 520 aa     Download sequence    Send to blast
MRVPVKSPQN SQSQSPKRVS SNNNINSVNV IARNIGIRSR PNSSNKCYEP TSVLELRRSP  60
SPVAENEKPA TVASACATEI SANISSDPSI EWEEHVLRTM DWESAMKDLG LDDYYSSVPS  120
NPTTSDPDPH LQIRQNLTLT DSVHLLDQSY FNFNIPDICP SSSQHDQGFI VGNNFSAVDV  180
SSNSLVINAS SSATGTNIVN VGFEFDFIQE LLRAADCFDS NELRLAQIIL ARLNQRLRSP  240
AGKPLERAAF FFKEALNSLL NGLTRPTCLS LWPEIIQSVR AYKAFSGMSP IPMFTHFTTT  300
QALLESLEGS PVPLIHIIDF DIGFGSQYAS FMREIAEKAH QYHSGSKLMN LTSLRITAIV  360
SEGYVNETRL IKDNLVHFAQ ELRIRFHVDF LLLRTFEMLS FKAVKFMDGE KTSVVLSPTI  420
FRRLANSTNN AVAFVNDLRR ISPTVVVFTD NEAWAECGSV PLFRRNFVNS LEYYTMVFES  480
LDAAAMNARD WARKIETYLL RPKITAAVEV AGARVAPWRE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-1124150836296GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006425721.10.0hypothetical protein CICLE_v10025246mg
RefseqXP_006466756.10.0PREDICTED: scarecrow-like protein 15
TrEMBLA0A067D0C50.0A0A067D0C5_CITSI; Uncharacterized protein (Fragment)
STRINGPOPTR_0007s12480.11e-157(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM42912857
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36710.11e-122GRAS family protein